Your Cart
📢 Follow our NEW Instagram & Get 10% Off! @ukpeptidesofficial 🔥

Sermorelin (GRF 1-29 ) 2mg

Important Note:

Ensure the peptide and mixing solution are at room temperature before use to ensure correct mixing. Avoid over-dilution, as this can destabilise the peptide. *Mixing water is sold separately.

Sermorelin (GRF 1-29 ) 2mg
Selling fast
Sermorelin (GRF 1-29 ) 2mg
from
£12.95
5 or more £12.50
10 or more £11.50
50 or more £10.25
  • Stock: 666
  • Model: Sermorelin 2mg
  • Molecular Formula: C149H246N44O42S
  • SKU: SER-022
  • Research Only: Yes
Products Sold: 13080
Product Views: 65184

Certificate of analysis

PDF COA

Sermorelin Acetate 2mg - High-Quality Research Peptide

Sermorelin Acetate, offered at 5mg, is a high-quality specialised research peptide developed for advanced scientific exploration in endocrinology and related fields. This product is ideal for laboratory settings where precision and reliability are paramount.

  • Product Name: Sermorelin Acetate 2mg
  • Catalogue Number: UKSERM2
  • Molecular Formula: C149H246N44O42S
  • Molecular Weight: 3358.9 g/mol
  • Purity: ≥98%
  • Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 (acetate salt)
  • Form: Lyophilised Solid

Usage and Storage:

Sermorelin Acetate is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website's detailed reconstitution and storage guidelines.

Synthesis and Quality Assurance:

Sermorelin Acetate is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.

Legal and Safety Information:

UK-Peptides proudly provides Sermorelin Acetate strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including Sermorelin Acetate, are not designed for human consumption or clinical application.

If you require high-quality Sermorelin Acetate for your research in the UK, explore our range of peptides designed for scientific rigour and innovation.

Physical and chemical properties
Molecular FormulaC151H250N44O44S
Molecular Weight3417.985 g/mol
Physical AppearanceWhite lyophilised solid
StorageLyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18°C. Upon reconstitution of the peptide, it should be stored at 4°C between 2-21 days and for future use below -18°C.
Research use
CautionResearch use only / Not for human or veterinary use

We do not accept reviews as these products are for research use only